Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens CART prepropeptide (CARTPT) (NM_004291). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q16568 |
| Entry Name | CART_HUMAN |
| Gene Names | CARTPT CART |
| Alternative Gene Names | CART |
| Alternative Protein Names | Cocaine- and amphetamine-regulated transcript protein [Cleaved into: CART(1-39); CART(42-89)] |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 116 |
| Molecular Weight(Da) | 12829 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL |
Background
| Function | FUNCTION: Satiety factor closely associated with the actions of leptin and neuropeptide Y; this anorectic peptide inhibits both normal and starvation-induced feeding and completely blocks the feeding response induced by neuropeptide Y and regulated by leptin in the hypothalamus. It promotes neuronal development and survival in vitro. {ECO:0000269|PubMed:9590691}. |
| Pathway | |
| Protein Families | CART family |
| Tissue Specificity | Hypothalamus. Found in neurons of the ventrolateral part of the arcuate nucleus, in the external zone of the median eminence, and also found in terminals in the periventricular part of the paraventricular nucleus. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |